Abstract:The tau protein plays an important role in some neurodegenerative diseases including Alzheimer's disease (AD). Neurofibrillary tangles (NFTs), a biological marker for AD, are aggregates of bundles of paired helical filaments (PHFs). In general, the a-sheet structure favors abet-rant protein aggregates. However, some reports have shown that the a-helix structure is capable of triggering the formation of abet-rant tau protein aggregates and PHFs have a high a-helix content. In addition, the third repeat fragment in the four-repeat microtubule-binding domain of the tau protein (residues 306-336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ, according to the longest tau protein) adopts a helical structure in trifluoroethanol (TFE) and may be a self-assembly model in the tau protein. In the human brain, there is a very small quantity of copper, which performs an important function. In our study, by means of matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), circular dichroism (CD), and nuclear magnetic resonance (NMR) spectroscopy, the binding properties of copper (II) ion to the R3 peptide derived from the third repeat fragment (residues 318-335: VTSKCGSLGNIHHKPGGG) have been investigated. The results show that copper ions bind to the R3 peptide. CD spectra, ultraviolet (UV)-visible absorption spectra, and MALDI-TOF MS show pH dependence and stoichiometry of Cu2+ binding. Furthermore, CD spectra and NMR spectroscopy elucidate the copper binding sites located in the R3 peptide. Finally, CD spectra reveal that the R3 peptide adopts a mixture structure of random structures, a-helices, and P-turns in aqueous solutions at physiological pH. At pH 7.5, the addition of 0.25 mot eq of Cu2+ induces the conformational change from the mixture mentioned above to a monomeric helical structure, and a P-sheet structure forms in the presence of 1 mol eq of Cu2+. As a-helix and P-sheet structures are responsible for the formation of PHFs, it is hypothesized that Cu2+ is an inducer of self-assembly of the R3 peptide and makes the R3 peptide form a structure like PHF. Hence, it is postulated that Cu2+ plays an important role in the aggregation of the R3 peptide and tau protein and that copper (II) binding may be another possible involvement in AD. (c) 2005 Wiley Periodicals, Inc.

The Impacts of Hg(II) Tightly Binding on the Alzheimer’s Tau Construct R3: Misfolding and Aggregation

Mercury(Ii) Promotes The In Vitro Aggregation Of Tau Fragment Corresponding To The Second Repeat Of Microtubule-Binding Domain: Coordination And Conformational Transition

Impacts of Cd(II) on the Conformation and Self-Aggregation of Alzheimer's Tau Fragment Corresponding to the Third Repeat of Microtubule-Binding Domain

Cooperative Folding of Tau Peptide by Coordination of Group IIB Metal Cations During Heparin-Induced Aggregation

Binding of copper (II) ion to an Alzheimer's tau peptide as revealed by MALDI-TOF MS, CD, and NMR.

Fibrillization Of Human Tau Is Accelerated By Exposure To Lead Via Interaction With His-330 And His-362

Copper (Cu<SUP>2+</SUP>) ion-induced misfolding of tau protein R3 peptide revealed by enhanced molecular dynamics simulation

Copper (II) Modulates in Vitro Aggregation of a Tau Peptide.

Effects of aluminum on amyloid-beta aggregation in the context of Alzheimer’s disease

Alzheimer disease hyperphosphorylated tau aggregates hydrophobically

Copper Binding Properties of a Tau Peptide Associated with Alzheimer's Disease Studied by CD, NMR, and MALDI-TOF MS.

Pathological Concentration of Zinc Dramatically Accelerates Abnormal Aggregation of Full-Length Human Tau and Thereby Significantly Increases Tau Toxicity in Neuronal Cells.

Mechanistic Insights and Future Challenges

Mechanisms Underlying Aluminum Neurotoxicity Related to 14-3-3ζ Protein.

Cu2+ Affects Amyloid-\b{eta} (1-42) Aggregation by Increasing Peptide-Peptide Binding Forces

Aggregation of Microtubule Binding Repeats of Tau Protein is Promoted by Cu 2 .

Uncovering the Effect of Ps202/pt205/ps208 Triple Phosphorylations on the Conformational Features of the Key Fragment G192-T212 of Tau Protein

Unraveling the Structure and Dynamics of Ac-PHF6-NH2 Tau Segment Oligomers

Zinc Binding to Tau Influences Aggregation Kinetics and Oligomer Distribution

Unravelling the Structure and Dynamics of Ac-PHF6-NH2 Tau Segment Oligomers

Zn(II)-Driven Impact of Monomeric Transthyretin on Amyloid-beta Amyloidogenesis