Abstract:The tau protein plays an important role in some neurodegenerative diseases including Alzheimer's disease (AD). Neurofibrillary tangles (NFTs), a biological marker for AD, are aggregates of bundles of paired helical filaments (PHFs). In general, the a-sheet structure favors abet-rant protein aggregates. However, some reports have shown that the a-helix structure is capable of triggering the formation of abet-rant tau protein aggregates and PHFs have a high a-helix content. In addition, the third repeat fragment in the four-repeat microtubule-binding domain of the tau protein (residues 306-336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ, according to the longest tau protein) adopts a helical structure in trifluoroethanol (TFE) and may be a self-assembly model in the tau protein. In the human brain, there is a very small quantity of copper, which performs an important function. In our study, by means of matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), circular dichroism (CD), and nuclear magnetic resonance (NMR) spectroscopy, the binding properties of copper (II) ion to the R3 peptide derived from the third repeat fragment (residues 318-335: VTSKCGSLGNIHHKPGGG) have been investigated. The results show that copper ions bind to the R3 peptide. CD spectra, ultraviolet (UV)-visible absorption spectra, and MALDI-TOF MS show pH dependence and stoichiometry of Cu2+ binding. Furthermore, CD spectra and NMR spectroscopy elucidate the copper binding sites located in the R3 peptide. Finally, CD spectra reveal that the R3 peptide adopts a mixture structure of random structures, a-helices, and P-turns in aqueous solutions at physiological pH. At pH 7.5, the addition of 0.25 mot eq of Cu2+ induces the conformational change from the mixture mentioned above to a monomeric helical structure, and a P-sheet structure forms in the presence of 1 mol eq of Cu2+. As a-helix and P-sheet structures are responsible for the formation of PHFs, it is hypothesized that Cu2+ is an inducer of self-assembly of the R3 peptide and makes the R3 peptide form a structure like PHF. Hence, it is postulated that Cu2+ plays an important role in the aggregation of the R3 peptide and tau protein and that copper (II) binding may be another possible involvement in AD. (c) 2005 Wiley Periodicals, Inc.

Copper Binding Properties of a Tau Peptide Associated with Alzheimer's Disease Studied by CD, NMR, and MALDI-TOF MS.

Binding of copper (II) ion to an Alzheimer's tau peptide as revealed by MALDI-TOF MS, CD, and NMR.

Copper (II) Modulates in Vitro Aggregation of a Tau Peptide.

Copper (Cu<SUP>2+</SUP>) ion-induced misfolding of tau protein R3 peptide revealed by enhanced molecular dynamics simulation

Characterization of Copper Binding to the Peptide Amyloid-Beta(1-16) Associated with Alzheimer'S Disease

Copper Binding to the Amyloid-β (Aβ) Peptide Associated with Alzheimer's Disease

Aggregation of Microtubule Binding Repeats of Tau Protein is Promoted by Cu 2 .

Impacts of Cd(II) on the Conformation and Self-Aggregation of Alzheimer's Tau Fragment Corresponding to the Third Repeat of Microtubule-Binding Domain

Cooperative Folding of Tau Peptide by Coordination of Group IIB Metal Cations During Heparin-Induced Aggregation

Cysteine in the R3 Tau Peptide Modulates Hemin Binding and Reactivity

Cu2+ Affects Amyloid-\b{eta} (1-42) Aggregation by Increasing Peptide-Peptide Binding Forces

Synthesis and conformational properties of phosphopeptides related to the human tau protein.

Characterization of Copper Interactions with Alzheimer Amyloid β Peptides: Identification of an Attomolar-Affinity Copper Binding Site on Amyloid β1-42

Molecular-Level Examination of Cu2+ Binding Structure for Amyloid Fibrils of 40-Residue Alzheimer’s Β by Solid-State NMR Spectroscopy

Copper mediates dityrosine cross-linking of Alzheimer's amyloid-beta.

Characterization of Copper Interactions with Alzheimer Amyloid β Peptides

Mercury(Ii) Promotes The In Vitro Aggregation Of Tau Fragment Corresponding To The Second Repeat Of Microtubule-Binding Domain: Coordination And Conformational Transition

A Copper-Binding Peptide with Therapeutic Potential against Alzheimer's Disease: From the Blood-Brain Barrier to Metal Competition

The Impacts of Hg(II) Tightly Binding on the Alzheimer’s Tau Construct R3: Misfolding and Aggregation

A Copper-Selective Sensor and Its Inhibition of Copper-Amyloid Beta Aggregation

Peptide backbone-copper ring structure: A molecular insight into copper-induced amyloid toxicity