Abstract:The tau protein plays an important role in some neurodegenerative diseases including Alzheimer's disease (AD). Neurofibrillary tangles (NFTs), a biological marker for AD, are aggregates of bundles of paired helical filaments (PHFs). In general, the a-sheet structure favors abet-rant protein aggregates. However, some reports have shown that the a-helix structure is capable of triggering the formation of abet-rant tau protein aggregates and PHFs have a high a-helix content. In addition, the third repeat fragment in the four-repeat microtubule-binding domain of the tau protein (residues 306-336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ, according to the longest tau protein) adopts a helical structure in trifluoroethanol (TFE) and may be a self-assembly model in the tau protein. In the human brain, there is a very small quantity of copper, which performs an important function. In our study, by means of matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), circular dichroism (CD), and nuclear magnetic resonance (NMR) spectroscopy, the binding properties of copper (II) ion to the R3 peptide derived from the third repeat fragment (residues 318-335: VTSKCGSLGNIHHKPGGG) have been investigated. The results show that copper ions bind to the R3 peptide. CD spectra, ultraviolet (UV)-visible absorption spectra, and MALDI-TOF MS show pH dependence and stoichiometry of Cu2+ binding. Furthermore, CD spectra and NMR spectroscopy elucidate the copper binding sites located in the R3 peptide. Finally, CD spectra reveal that the R3 peptide adopts a mixture structure of random structures, a-helices, and P-turns in aqueous solutions at physiological pH. At pH 7.5, the addition of 0.25 mot eq of Cu2+ induces the conformational change from the mixture mentioned above to a monomeric helical structure, and a P-sheet structure forms in the presence of 1 mol eq of Cu2+. As a-helix and P-sheet structures are responsible for the formation of PHFs, it is hypothesized that Cu2+ is an inducer of self-assembly of the R3 peptide and makes the R3 peptide form a structure like PHF. Hence, it is postulated that Cu2+ plays an important role in the aggregation of the R3 peptide and tau protein and that copper (II) binding may be another possible involvement in AD. (c) 2005 Wiley Periodicals, Inc.

Copper (II) Modulates in Vitro Aggregation of a Tau Peptide.

Binding of copper (II) ion to an Alzheimer's tau peptide as revealed by MALDI-TOF MS, CD, and NMR.

Copper Binding Properties of a Tau Peptide Associated with Alzheimer's Disease Studied by CD, NMR, and MALDI-TOF MS.

Copper Binding to the Amyloid-β (Aβ) Peptide Associated with Alzheimer's Disease

Cu2+ Affects Amyloid-\b{eta} (1-42) Aggregation by Increasing Peptide-Peptide Binding Forces

Characterization of Copper Binding to the Peptide Amyloid-Beta(1-16) Associated with Alzheimer'S Disease

Aggregation of Microtubule Binding Repeats of Tau Protein is Promoted by Cu 2 .

Copper (Cu<SUP>2+</SUP>) ion-induced misfolding of tau protein R3 peptide revealed by enhanced molecular dynamics simulation

Characterization of Copper Interactions with Alzheimer Amyloid β Peptides

Copper mediates dityrosine cross-linking of Alzheimer's amyloid-beta.

Cu(II) potentiation of Alzheimer Abeta1-40 cytotoxicity and transition on its secondary structure

Characterization of Copper Interactions with Alzheimer Amyloid β Peptides: Identification of an Attomolar-Affinity Copper Binding Site on Amyloid β1-42

Molecular Modeling of the Inhibitory Mechanism of Copper(ii) on Aggregation of Amyloid Β-Peptide

Impacts of Cd(II) on the Conformation and Self-Aggregation of Alzheimer's Tau Fragment Corresponding to the Third Repeat of Microtubule-Binding Domain

A Novel Cu(II)-Binding Peptide Identified by Phage Display Inhibits Cu<SUP>2+</SUP>-Mediated A Aggregation

Amyloid-β Peptide （1-42） Aggregation Induced by Copper Ions under Acidic Conditions

Amyloid- Peptide (142) Aggregation Induced By Copper Ions Under Acidic Conditions

Redox-Dependent Copper Ion Modulation of Amyloid-β (1-42) Aggregation In Vitro

Copper accumulation and the effect of chelation treatment on cerebral amyloid angiopathy compared to parenchymal amyloid plaques

Cu(II) Enhances the Effect of Alzheimer’s Amyloid-Β Peptide on Microglial Activation

A Novel Cu(II)-Binding Peptide Identified by Phage Display Inhibits Cu2+-Mediated Aβ Aggregation