Abstract:The tau protein plays an important role in some neurodegenerative diseases including Alzheimer's disease (AD). Neurofibrillary tangles (NFTs), a biological marker for AD, are aggregates of bundles of paired helical filaments (PHFs). In general, the a-sheet structure favors abet-rant protein aggregates. However, some reports have shown that the a-helix structure is capable of triggering the formation of abet-rant tau protein aggregates and PHFs have a high a-helix content. In addition, the third repeat fragment in the four-repeat microtubule-binding domain of the tau protein (residues 306-336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ, according to the longest tau protein) adopts a helical structure in trifluoroethanol (TFE) and may be a self-assembly model in the tau protein. In the human brain, there is a very small quantity of copper, which performs an important function. In our study, by means of matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), circular dichroism (CD), and nuclear magnetic resonance (NMR) spectroscopy, the binding properties of copper (II) ion to the R3 peptide derived from the third repeat fragment (residues 318-335: VTSKCGSLGNIHHKPGGG) have been investigated. The results show that copper ions bind to the R3 peptide. CD spectra, ultraviolet (UV)-visible absorption spectra, and MALDI-TOF MS show pH dependence and stoichiometry of Cu2+ binding. Furthermore, CD spectra and NMR spectroscopy elucidate the copper binding sites located in the R3 peptide. Finally, CD spectra reveal that the R3 peptide adopts a mixture structure of random structures, a-helices, and P-turns in aqueous solutions at physiological pH. At pH 7.5, the addition of 0.25 mot eq of Cu2+ induces the conformational change from the mixture mentioned above to a monomeric helical structure, and a P-sheet structure forms in the presence of 1 mol eq of Cu2+. As a-helix and P-sheet structures are responsible for the formation of PHFs, it is hypothesized that Cu2+ is an inducer of self-assembly of the R3 peptide and makes the R3 peptide form a structure like PHF. Hence, it is postulated that Cu2+ plays an important role in the aggregation of the R3 peptide and tau protein and that copper (II) binding may be another possible involvement in AD. (c) 2005 Wiley Periodicals, Inc.

A Copper Complex Formed with Neurokinin B: Binding Stoichiometry, Redox Properties, Self-Assembly and Cytotoxicity

Nanostructure and dynamics of N-truncated copper amyloid-β peptides from advanced X-ray absorption fine structure

Peptide backbone-copper ring structure: A molecular insight into copper-induced amyloid toxicity

Investigating Cu(I) binding to model peptides of N-terminal Aβ isoforms

Copper (II) Modulates in Vitro Aggregation of a Tau Peptide.

Redox-Dependent Copper Ion Modulation of Amyloid-β (1-42) Aggregation In Vitro

Copper inducing Aβ42 rather than Aβ40 nanoscale oligomer formation is the key process for Aβ neurotoxicity.

Copper Binding to the Amyloid-β (Aβ) Peptide Associated with Alzheimer's Disease

Characterization of Copper Binding to the Peptide Amyloid-Beta(1-16) Associated with Alzheimer'S Disease

A Copper-Selective Sensor and Its Inhibition of Copper-Amyloid Beta Aggregation

Mechanistic approaches for chemically modifying the coordination sphere of copper–amyloid-β complexes

Molecular-Level Examination of Cu2+ Binding Structure for Amyloid Fibrils of 40-Residue Alzheimer’s Β by Solid-State NMR Spectroscopy

Characterization of Copper Interactions with Alzheimer Amyloid β Peptides: Identification of an Attomolar-Affinity Copper Binding Site on Amyloid β1-42

Cu(II) Potentiation of Alzheimer Aβ Neurotoxicity

Cu(II) Enhances the Effect of Alzheimer’s Amyloid-Β Peptide on Microglial Activation

Identifying the Copper Coordination Environment Between Interacting Neurodegenerative Proteins: A New Approach Using Pulsed EPR with N/ N Isotopic Labelling

Redox Reactions Of The Alpha-Synuclein-Cu2+ Complex And Their Effects On Neuronal Cell Viability

Binding of copper (II) ion to an Alzheimer's tau peptide as revealed by MALDI-TOF MS, CD, and NMR.

Characterization of Copper Interactions with Alzheimer Amyloid β Peptides

NAP Neuroprotective Peptide and its Analogs: Simultaneously Copper and Iron Binding and Reduction

Blocking creatine kinase refolding by trace amounts of copper ions.