Identification of a Novel Linear B Cell Epitope on the Sao Protein of Streptococcus suis Serotype 2

Jing Wang,Ruirui Dong,Ping Zou,Yuejuan Chen,Na Li,Yao Wang,Ting Zhang,Xiuzhen Pan
DOI: https://doi.org/10.3389/fimmu.2020.01492
IF: 7.3
2020-07-16
Frontiers in Immunology
Abstract:Surface antigen one (Sao) protein is a bacterial surface protein identified in the important zoonotic pathogen <i>Streptococcus suis</i> serotype 2 (<i>S</i>. <i>suis 2</i>) during an extensive search for functional proteins. The Sao protein is anchored to the bacterial cell wall by the LPVTG motif and is widely distributed in many <i>S</i>. <i>suis</i> serotypes. In this paper, we present the immunodominant epitope peptide of the Sao protein that is recognized by BALB/c antibodies against the Sao protein: <sup>355</sup>SEKQMPSVVNENAVTPEKQMTNKENDNIET<sup>384</sup> (location Sao<sub>355−384</sub>). To determine the core epitope recognized by antibodies, we prepared truncation peptide libraries. Analyses of the immunoreactivity of truncation peptides with anti-Sao<sub>355−384</sub> serum revealed that the most immunoreactive sequence was <sup>355</sup>SEKQMPSVVNENAVTPEK<sup>372</sup> (location Sao<sub>355−372</sub>). Moreover, we observed that this core epitope also showed good specificity based on the ratio of reactivity with serum from <i>S</i>. <i>suis</i>–positive patients compared to serum from <i>S</i>. <i>suis</i>–negative patients. Our results point to the potential of using the Sao<sub>355−372</sub> peptide in diagnostic assays to determine <i>S</i>. <i>suis</i> infection in humans.
immunology
What problem does this paper attempt to address?